PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g15327.1.p
Common NameBRADI_3g15327, LOC100843786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HD-ZIP
Protein Properties Length: 813aa    MW: 86850.8 Da    PI: 5.8626
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g15327.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.4e-21119175157
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Bradi3g15327.1.p 119 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 175
                       688999************************************************995 PP

2START200.85.9e-633235431206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS.............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv............dsgealrasgvvdmvlallveellddkeqWdet 75 
                       ela +a++el+++a ++ep+W++s+      e         ++e ++v             + ea+r   vv+m++a lve+l+d++ q+ + 
  Bradi3g15327.1.p 323 ELAVAAMDELLQMARVDEPLWSSSAtgeaalE---------EEEYGRVygarglgprqygLKPEASRGANVVIMTHASLVEILMDVN-QFATV 405
                       57899********************6644443.........443333344444667788999*************************.88888 PP

                       -S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEE CS
             START  76 la....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepk 157
                       +     +a+t+ev+s+g      galq+m++e+q++splvp R+++fvRy++  ++g+w++vdvS+ds ++ p     v+++++pSg+li+++
  Bradi3g15327.1.p 406 FSsivsRASTHEVLSTGvagnydGALQVMSMEFQVPSPLVPtRESYFVRYCKHNPEGSWAVVDVSLDSLRPSPA----VKCRRRPSGCLIQEL 494
                       888888*****************************************************************995....*************** PP

                       CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       +ng+skvtwvehv++++r++h ++++lv+sgla+gak+wv tl+rqce+
  Bradi3g15327.1.p 495 PNGYSKVTWVEHVEVDDRSVHDIYKPLVNSGLAFGAKRWVGTLGRQCER 543
                       ***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-24101174IPR009057Homeodomain-like
SuperFamilySSF466891.96E-20107176IPR009057Homeodomain-like
PROSITE profilePS5007117.605116176IPR001356Homeobox domain
SMARTSM003892.5E-20117180IPR001356Homeobox domain
PfamPF000461.6E-18119174IPR001356Homeobox domain
CDDcd000864.47E-20119177No hitNo description
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084840.065314546IPR002913START domain
SuperFamilySSF559611.99E-33316545No hitNo description
CDDcd088751.63E-111318542No hitNo description
SMARTSM002341.7E-59323543IPR002913START domain
PfamPF018527.5E-53324543IPR002913START domain
Gene3DG3DSA:3.30.530.204.8E-6390537IPR023393START-like domain
SuperFamilySSF559617.56E-25565800No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 813 aa     Download sequence    Send to blast
MTPARRLPPM IGRNGVAYGS PSALSLSQAD LLDSHHLQQA LIQQQLYEQI PATMSTPGAV  60
VNHMHNLHGM PAPDELESKS CSENNGADAD ADGTGGGGGS GGEEGEGEEQ DPNQRPRKKK  120
RYHRHTQHQI QELEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKNQHEKQ  180
ENSQLRAEND KLRAENMRYK EALSSASCPS CGGPAALGEM SFDEHHLRVD NARLRDEIDR  240
ISAIAAKHVA ATGKPMPFPM PMAGLSSSAA SFHGLSPAVA ARSPLDLVGA YGGGGDMFGG  300
GAGAGDLMRS HGLGDVDKPL IVELAVAAMD ELLQMARVDE PLWSSSATGE AALEEEEYGR  360
VYGARGLGPR QYGLKPEASR GANVVIMTHA SLVEILMDVN QFATVFSSIV SRASTHEVLS  420
TGVAGNYDGA LQVMSMEFQV PSPLVPTRES YFVRYCKHNP EGSWAVVDVS LDSLRPSPAV  480
KCRRRPSGCL IQELPNGYSK VTWVEHVEVD DRSVHDIYKP LVNSGLAFGA KRWVGTLGRQ  540
CERLASAMAS SIPNGDLGVI TSVEGRKSML KLAERMVASF CGGVTASVAH QWTTLSGSGA  600
EDVRVMTRKS VDDPGRPPGI VLNAATSFWL PVSPNTVFDF LRDETSRSEW DILSNGGIVQ  660
EMAHIANGRD HGNCVSLLRV NSANSNQSNM LILQESCTDE SGSSYVVYAP VDIVAMNVVL  720
NGGDPDYVAL LPSGFAILPD GPSAPLSGIN EEGGVAAGKG GSLLTVAFQI LVDSVPTAKL  780
SLGSVATVNS LIACTVERIK AAVCRGGSSN PQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0779930.0AB077993.1 Oryza sativa mRNA for Roc1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234329.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
RefseqXP_003573403.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLI1I1170.0I1I117_BRADI; Uncharacterized protein
STRINGBRADI3G15327.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2